PHF12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PHF12 antibody: synthetic peptide directed towards the C terminal of human PHF12. Synthetic peptide located within the following region: NVLYSCDFSEKTPPTPPSSIVAKVQSVIRRRRHQKQDEEPSEEAAMMSSQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	110 kDa
Gene Name	PHD finger protein 12
Database Link	NP_001028733 Entrez Gene 57649 Human UniProt ID Q96QT6
Background	PHF12 acts as a transcriptional repressor. It is involved in recruitment of functional SIN3A complexes to DNA. PHF12 represses transcription at least in part through the activity of an associated histone deacetylase (HDAC). IT may also repress transcription in a SIN3A-independent manner through recruitment of functional AES complexes to DNA.
Synonyms	PF1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.