ARID3C Rabbit Polyclonal Antibody
CAT#: TA339645
Rabbit Polyclonal Anti-ARID3C Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ARID3C antibody: synthetic peptide directed towards the C terminal of human ARID3C. Synthetic peptide located within the following region: MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 44 kDa |
Gene Name | AT-rich interaction domain 3C |
Database Link | |
Background | ARID3C is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-318 AL450283.16 15235-15552 c 319-391 AL450283.16 13280-13352 c 392-575 AL450283.16 11402-11585 c 576-865 AL450283.16 10963-11252 c 866-1048 AL450283.16 9885-10067 c 1049-1138 AL450283.16 9558-9647 c 1139-1239 AL450283.16 8996-9096 c |
Synonyms | AT rich interactive domain 3C (BRIGHT- like); AT rich interactive domain 3C (BRIGHT-like) |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Bovine: 92%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |