FIBCD1 Rabbit Polyclonal Antibody
CAT#: TA339634
Rabbit Polyclonal Anti-FIBCD1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB, IF |
Reactivity | Mouse, Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FIBCD1 antibody: synthetic peptide directed towards the C terminal of human FIBCD1. Synthetic peptide located within the following region: DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | fibrinogen C domain containing 1 |
Database Link | |
Background | FIBCD1 is a single-pass membrane protein. It contains 1 fibrinogen C-terminal domain. The exact function of FIBCD1 remains unknown. |
Synonyms | FLJ14810 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 92%; Zebrafish: 92%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |