St6gal2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-St6gal2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	beta galactoside alpha 2,6 sialyltransferase 2
Database Link	NP_766417 Entrez Gene 240119 Mouse UniProt ID Q76K27
Background	The function of this protein remains unknown.
Synonyms	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2; FLJ30711; FLJ37730; FLJ38334; KIAA1877; SIAT2; ST6Gal-II; ST6GalII
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Guinea pig: 86%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.