PCDHA6 Rabbit Polyclonal Antibody
CAT#: TA339583
Rabbit Polyclonal Anti-PCDHA6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PCDHA6 antibody is: synthetic peptide directed towards the N-terminal region of Human PCDHA6. Synthetic peptide located within the following region: LAAWKVGSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 75 kDa |
Gene Name | protocadherin alpha 6 |
Database Link | |
Background | PCDHA6 is a potential calcium-dependent cell-adhesion protein, It may be involved in the establishment and maintenance of specific neuronal connections in the brain. |
Synonyms | CNR2; CNRN2; CNRS2; CRNR2; PCDH-ALPHA6 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Rabbit: 92%; Horse: 86%; Bovine: 86%; Zebrafish: 85% |
Reference Data | |
Protein Families | Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |