ZNF581 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF581 antibody: synthetic peptide directed towards the middle region of human ZNF581. Synthetic peptide located within the following region: QREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	zinc finger protein 581
Database Link	NP_057619 Entrez Gene 51545 Human UniProt ID Q9P0T4
Background	May be involved in transcriptional regulation.
Synonyms	HSPC189
Note	Immunogen Sequence Homology: Human: 100%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.