VSX1 Rabbit Polyclonal Antibody

CAT#: TA339470

Rabbit Polyclonal Anti-VSX1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human visual system homeobox 1 (VSX1), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of visual system homeobox 1 (VSX1), transcript variant 2
    • 100 ug

CNY 3,080.00


Transient overexpression lysate of visual system homeobox 1 (VSX1), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-VSX1 antibody: synthetic peptide directed towards the middle region of human VSX1. Synthetic peptide located within the following region: LAGLWGSDHFKEGSSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 38 kDa
Gene Name visual system homeobox 1
Background The protein encoded by this gene contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. The encoded protein may regulate expression of the cone opsin genes early in development. Mutations in this gene can cause posterior polymorphous corneal dystrophy and keratoconus. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Synonyms CAASDS; KTCN; KTCN1; PPCD; PPCD1; PPD; RINX
Note Immunogen Sequence Homology: Human: 100%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...