GRPEL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GRPEL1 antibody: synthetic peptide directed towards the N terminal of human GRPEL1. Synthetic peptide located within the following region: NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	GrpE like 1, mitochondrial
Database Link	NP_079472 Entrez Gene 80273 Human UniProt ID Q9HAV7
Background	GRPEL1 is essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL1 seems to control the nucleotide-depe
Synonyms	HMGE
Note	Immunogen Sequence Homology: Human: 100%; Pig: 75%; Guinea pig: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.