CEP55 Rabbit Polyclonal Antibody
CAT#: TA339345
Rabbit Polyclonal Anti-CEP55 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CEP55 antibody: synthetic peptide directed towards the N terminal of human CEP55. Synthetic peptide located within the following region: MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | centrosomal protein 55 |
Database Link | |
Background | CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation. |
Synonyms | C10orf3; CT111; URCC6 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 92%; Dog: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 85%; Horse: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |