CEP55 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CEP55 antibody: synthetic peptide directed towards the N terminal of human CEP55. Synthetic peptide located within the following region: MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	centrosomal protein 55
Database Link	NP_060601 Entrez Gene 55165 Human UniProt ID Q53EZ4
Background	CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
Synonyms	C10orf3; CT111; URCC6
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 92%; Dog: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 85%; Horse: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.