ZNF192 (ZKSCAN8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF192 antibody: synthetic peptide directed towards the N terminal of human ZNF192. Synthetic peptide located within the following region: MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	zinc finger with KRAB and SCAN domains 8
Database Link	NP_006289 Entrez Gene 7745 Human UniProt ID Q15776
Background	May be involved in transcriptional regulation.
Synonyms	LD5-1; ZNF192; ZSCAN40
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 93%; Mouse: 86%; Goat: 85%; Horse: 85%; Bovine: 85%; Rabbit: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.