ILF2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ILF2 antibody: synthetic peptide directed towards the C terminal of human ILF2. Synthetic peptide located within the following region: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEGEEEEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	interleukin enhancer binding factor 2
Database Link	NP_004506 Entrez Gene 3608 Human UniProt ID Q12905
Background	The protein encoded by this gene is the 45 kDa component of nuclear factor of activated T-cells (NFAT), a heterodimer of 45 kDa and 90 kDa proteins. NFAT is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The complex has been shown to repair DNA breaks by nonhomologous end joining and can also negatively regulate the microRNA processing pathway. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. [provided by RefSeq, Jun 2012]
Synonyms	NF45; PRO3063
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.