ZMPSTE24 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZMPSTE24 antibody: synthetic peptide directed towards the N terminal of human ZMPSTE24. Synthetic peptide located within the following region: LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	zinc metallopeptidase STE24
Database Link	NP_005848 Entrez Gene 10269 Human UniProt ID O75844
Background	This gene encodes a member of the peptidase M48A family. The encoded protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in this gene have been associated with mandibuloacral dysplasia and restrictive dermopathy. [provided by RefSeq, Jul 2008]
Synonyms	FACE-1; FACE1; HGPS; PRO1; STE24; Ste24p
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 91%; Zebrafish: 90%; Pig: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Families	Druggable Genome, Protease, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.