SERCA3 (ATP2A3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	109 kDa
Gene Name	ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
Database Link	NP_005164 Entrez Gene 489 Human UniProt ID Q93084
Background	This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Synonyms	SERCA3
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 86%; Pig: 79%; Rat: 79%; Bovine: 79%; Guinea pig: 79%; Rabbit: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Alzheimer's disease, Calcium signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.