IFIT3 Rabbit Polyclonal Antibody

CAT#: TA338978

Rabbit Polyclonal Anti-IFIT3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 1
    • 100 ug

CNY 3,080.00


Recombinant protein of human interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), transcript variant 2
    • 100 ug

CNY 4,840.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-IFIT3 antibody: synthetic peptide directed towards the N terminal of human IFIT3. Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name interferon induced protein with tetratricopeptide repeats 3
Background The function remains unknown.
Synonyms CIG-49; GARG-49; IFI60; IFIT4; IRG2; ISG60; P60; RIG-G
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Mouse: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...