IFIT3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IFIT3 antibody: synthetic peptide directed towards the N terminal of human IFIT3. Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	interferon induced protein with tetratricopeptide repeats 3
Database Link	NP_001026853 Entrez Gene 3437 Human UniProt ID O14879
Background	The function remains unknown.
Synonyms	CIG-49; GARG-49; IFI60; IFIT4; IRG2; ISG60; P60; RIG-G
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.