TCP10L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TCP10L antibody: synthetic peptide directed towards the middle region of human TCP10L. Synthetic peptide located within the following region: ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	t-complex 10-like
Database Link	NP_653260 Entrez Gene 140290 Human UniProt ID Q8TDR4
Background	TCP10L is a human leucine zipper protein with transcription inhibition activity.
Synonyms	C21orf77; PRED77; TCP10A-2
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.