GATD3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C21orf33 antibody: synthetic peptide directed towards the N terminal of human C21orf33. Synthetic peptide located within the following region: SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	chromosome 21 open reading frame 33
Database Link	NP_937798 Entrez Gene 8209 Human UniProt ID P0DPI2
Background	This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Synonyms	ES1; GT335; HES1; KNPH; KNPI
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Sheep: 93%; Bovine: 93%; Mouse: 92%; Pig: 86%; Horse: 86%; Zebrafish: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.