CBR1 Rabbit Polyclonal Antibody

CAT#: TA338914

Rabbit Polyclonal Anti-CBR1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,537.00


货期*
2周

规格
    • 100 ug

Product images

经常一起买 (4)
Transient overexpression lysate of carbonyl reductase 1 (CBR1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human carbonyl reductase 1 (CBR1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human carbonyl reductase 1 (CBR1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the C terminal of human CBR1. Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 30 kDa
Gene Name carbonyl reductase 1
Background The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]
Synonyms CBR; hCBR1; SDR21C1
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 92%; Bovine: 92%; Dog: 85%; Horse: 85%; Guinea pig: 85%
Reference Data
Protein Families Druggable Genome
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...