CBR1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the C terminal of human CBR1. Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	carbonyl reductase 1
Database Link	NP_001748 Entrez Gene 873 Human UniProt ID P16152
Background	The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2013]
Synonyms	CBR; hCBR1; SDR21C1
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 92%; Bovine: 92%; Dog: 85%; Horse: 85%; Guinea pig: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Arachidonic acid metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.