C15orf33 (FAM227B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM227B antibody is: synthetic peptide directed towards the N-terminal region of Human FAM227B. Synthetic peptide located within the following region: EYSLILQNHTSEIFKWKSMISETSSYRKLERYGEFLKKYHKKKKIMLSDE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	family with sequence similarity 227 member B
Database Link	NP_689860 Entrez Gene 196951 Human UniProt ID Q96M60
Background	The function of this protein remains unknown.
Synonyms	C15orf33
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.