AMDHD1 Rabbit Polyclonal Antibody
CAT#: TA338846
Rabbit Polyclonal Anti-AMDHD1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-AMDHD1 antibody: synthetic peptide directed towards the N terminal of human AMDHD1. Synthetic peptide located within the following region: AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | amidohydrolase domain containing 1 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | HMFT1272 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 92%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Horse: 79%; Bovine: 79%; Rabbit: 79% |
Reference Data | |
Protein Pathways | Histidine metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |