PIWIL4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	96
Gene Name	piwi like RNA-mediated gene silencing 4
Database Link	NP_689644 Entrez Gene 143689 Human UniProt ID Q7Z3Z4
Background	PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.
Synonyms	HIWI2; MIWI2
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Pathways	Dorso-ventral axis formation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.