PIWIL4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	96 kDa
Gene Name	piwi like RNA-mediated gene silencing 4
Database Link	NP_689644 Entrez Gene 143689 Human UniProt ID Q7Z3Z4
Background	PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]). [supplied by OMIM]
Synonyms	HIWI2; MIWI2
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Pathways	Dorso-ventral axis formation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.