GRPEL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GRPEL2 antibody: synthetic peptide directed towards the middle region of human GRPEL2. Synthetic peptide located within the following region: HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	GrpE like 2, mitochondrial
Database Link	NP_689620 Entrez Gene 134266 Human UniProt ID Q8TAA5
Background	GRPEL2 is an essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL2 seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. GRPEL2 stimulates ATPase activity of mt-HSP70. GRPEL2 may also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
Synonyms	Mt-GrpE#2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.