POLDIP1 (KCTD13) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KCTD13 antibody: synthetic peptide directed towards the N terminal of human KCTD13. Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	potassium channel tetramerization domain containing 13
Database Link	NP_849194 Entrez Gene 253980 Human UniProt ID Q8WZ19
Background	KCTD13 mRNA is expressed in 3T3-L1 adipocytes and THP-1 macrophages. It is suggested that this gene provides a link between cytokine activation and DNA replication in liver as well as in other tissues.
Synonyms	BACURD1; FKSG86; hBACURD1; PDIP1; POLDIP1
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%
Reference Data
Protein Families	Ion Channels: Other, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.