KCNG1 Rabbit Polyclonal Antibody
CAT#: TA338759
Rabbit Polyclonal Anti-KCNG1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNG1 antibody: synthetic peptide directed towards the N terminal of human KCNG1. Synthetic peptide located within the following region: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 58 kDa |
Gene Name | potassium voltage-gated channel modifier subfamily G member 1 |
Database Link | |
Background | Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Multiple alternatively spliced transcript variants have been found in normal and cancerous tissues. [provided by RefSeq, Jul 2008] |
Synonyms | K13; KCNG; kH2; KV6.1 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Pig: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |