SLC66A2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PQLC1 antibody: synthetic peptide directed towards the middle region of human PQLC1. Synthetic peptide located within the following region: TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	PQ loop repeat containing 1
Database Link	NP_079354 Entrez Gene 80148 Human UniProt ID Q8N2U9
Background	PQLC1 is a multi-pass membrane protein. It contains 2 PQ-loop domains. The exact function of PQLC1 remains unknown.
Synonyms	FLJ22378
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.