BTNL8 Rabbit Polyclonal Antibody
CAT#: TA338684
Rabbit Polyclonal Anti-BTNL8 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BTNL8 antibody: synthetic peptide directed towards the N terminal of human BTNL8. Synthetic peptide located within the following region: MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 57 kDa |
Gene Name | butyrophilin like 8 |
Database Link | |
Background | BTNL8 is a single-pass type I membrane protein. It belongs to the immunoglobulin superfamily, BTN/MOG family. BTNL8 contains 1 B30.2/SPRY domain and 1 Ig-like V-type domain. The exact function of BTNL8 remains unknown. |
Synonyms | BTN9.2 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 85% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |