TMEM180 (MFSD13A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM180 antibody: synthetic peptide directed towards the middle region of human TMEM180. Synthetic peptide located within the following region: CLFIASNRVFTEGTCKLLTLVVTDLVDEDLVLNHRKQAASALLFGMVALVT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	major facilitator superfamily domain containing 13A
Database Link	NP_079065 Entrez Gene 79847 Human UniProt ID Q14CX5
Background	The function of TMEM180 remains unknown.
Synonyms	bA18I14.8; C10orf77; TMEM180
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.