CHST8 Rabbit Polyclonal Antibody
CAT#: TA338606
Rabbit Polyclonal Anti-CHST8 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CHST8 antibody: synthetic peptide directed towards the middle region of human CHST8. Synthetic peptide located within the following region: GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 49 kDa |
Gene Name | carbohydrate sulfotransferase 8 |
Database Link | |
Background | Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates.Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates (Hiraoka et al., 2001 [PubMed 11445554]). [supplied by OMIM] |
Synonyms | GalNAc4ST; GALNAC4ST1; PSS3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 86%; Rabbit: 86% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |