GABA A Receptor alpha 1 (GABRA1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GABRA1 antibody: synthetic peptide directed towards the N terminal of human GABRA1. Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	gamma-aminobutyric acid type A receptor alpha1 subunit
Database Link	NP_000797 Entrez Gene 2554 Human UniProt ID P14867
Background	This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene cause juvenile myoclonic epilepsy and childhood absence epilepsy type 4. Multiple transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]
Synonyms	ECA4; EIEE19; EJM; EJM5
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Rat: 92%; Mouse: 92%; Pig: 86%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
Protein Pathways	Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.