ISLR2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ISLR2 antibody: synthetic peptide directed towards the N terminal of human ISLR2. Synthetic peptide located within the following region: PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	immunoglobulin superfamily containing leucine-rich repeat 2
Database Link	NP_065902 Entrez Gene 57611 Human UniProt ID Q6UXK2
Background	ISLR2 is a single-pass membrane protein. It contains 1 Ig-like (immunoglobulin-like) domain and 5 LRR (leucine-rich) repeats. The exact function of ISLR2 remains unknown.
Synonyms	LINX
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.