CEACAM19 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CEACAM19 antibody: synthetic peptide directed towards the middle region of human CEACAM19. Synthetic peptide located within the following region: MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	carcinoembryonic antigen related cell adhesion molecule 19
Database Link	NP_064604 Entrez Gene 56971 Human UniProt ID Q7Z692
Background	The specific function of the protein remains unknown.
Synonyms	CEACM19; CEAL1
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.