CNNM4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CNNM4 antibody: synthetic peptide directed towards the middle region of human CNNM4. Synthetic peptide located within the following region: LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	86 kDa
Gene Name	cyclin and CBS domain divalent metal cation transport mediator 4
Database Link	NP_064569 Entrez Gene 26504 Human UniProt ID Q6P4Q7
Background	CNNM4 belongs to the ACDP family.It is a metal transporter. The interaction with the metal ion chaperone COX11 suggests that CNNM4 may play a role in sensory neuron functions.
Synonyms	ACDP4
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 86%; Zebrafish: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.