RAGEF2 (RAPGEF6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAPGEF6 antibody is: synthetic peptide directed towards the N-terminal region of Human RAPGEF6. Synthetic peptide located within the following region: GSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQREIPA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	157 kDa
Gene Name	Rap guanine nucleotide exchange factor 6
Database Link	NP_001157861 Entrez Gene 51735 Human UniProt ID Q8TEU7
Background	RAPGEF6 is a guanine nucleotide exchange factor (GEF) for Rap1A, Rap2A and M-Ras GTPases. RAPGEF6 does not interact with cAMP.
Synonyms	KIA001LB; PDZ-GEF2; PDZGEF2; RA-GEF-2; RAGEF2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.