Semaphorin 7a (SEMA7A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SEMA7A antibody is: synthetic peptide directed towards the C-terminal region of Human SEMA7A. Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	semaphorin 7A (John Milton Hagen blood group)
Database Link	NP_003603 Entrez Gene 8482 Human UniProt ID O75326
Background	The protein encoded by this gene binds to cell surfaces through a glycosylphosphatidylinositol (GPI) linkage. The encoded glycoprotein is found on activated lymphocytes and erythrocytes. This protein may be involved in immunomodulatory and neuronal processes. Defects in this gene can result in loss of bone mineral density (BMD). Three transcript variants encoding different isoforms have been found for this gene.
Synonyms	CD108; CDw108; H-SEMA-K1; H-Sema-L; JMH; SEMAK1; SEMAL
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 79%
Reference Data
Protein Pathways	Axon guidance

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.