ANGPTL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANGPTL1 antibody is: synthetic peptide directed towards the N-terminal region of Human ANGPTL1. Synthetic peptide located within the following region: KINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	angiopoietin like 1
Database Link	NP_004664 Entrez Gene 9068 Human UniProt ID O95841
Background	Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The protein encoded by this gene is another member of the angiopoietin family that is widely expressed in adult tissues with mRNA levels highest in highly vascularized tissues. This protein was found to be a secretory protein that does not act as an endothelial cell mitogen in vitro.
Synonyms	ANG3; ANGPT3; AngY; ARP1; dJ595C2.2; UNQ162
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.