GPR7 (NPBWR1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NPBWR1 antibody is: synthetic peptide directed towards the N-terminal region of Human NPBWR1. Synthetic peptide located within the following region: FSEPWPANASGPDPALSCSNASTLAPLPAPLAVAVPVVYAVICAVGLAGN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	neuropeptides B/W receptor 1
Database Link	NP_005276 Entrez Gene 2831 Human UniProt ID P48145
Background	NPBWR1 interacts specifically with a number of opioid ligands. NPBWR1 is a receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals. NPBWR1 has a higher affinity for neuropeptide B.
Synonyms	GPR7
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane
Protein Pathways	Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.