CDC42 Binding Protein Kinase Beta (CDC42BPB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CDC42BPB antibody is: synthetic peptide directed towards the C-terminal region of Human CDC42BPB. Synthetic peptide located within the following region: GLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASEQETQAPKPEASPSMSVA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	194 kDa
Gene Name	CDC42 binding protein kinase beta
Database Link	NP_006026 Entrez Gene 9578 Human UniProt ID Q9Y5S2
Background	This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization.
Synonyms	MRCKB
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Dog: 92%; Rabbit: 86%; Mouse: 83%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.