CRISP3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CRISP3 antibody is: synthetic peptide directed towards the N-terminal region of Human CRISP3. Synthetic peptide located within the following region: PARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	cysteine rich secretory protein 3
Database Link	NP_006052 Entrez Gene 10321 Human UniProt ID P54108
Background	The function of this protein remains unknown.
Synonyms	Aeg2; CRISP-3; CRS3; dJ442L6.3; SGP28
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 77%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.