EAF2 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EAF2 antibody is: synthetic peptide directed towards the C-terminal region of Human EAF2. Synthetic peptide located within the following region: SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 29 kDa |
Gene Name | ELL associated factor 2 |
Database Link | |
Background | EAF2 acts as a transcriptional transactivator of TCEA1 elongation activity and a transcriptional transactivator of ELL and ELL2 elongation activities. EAF2 is a potent inducer of apoptosis in prostatic and non-prostatic cell lines and inhibits prostate tumor growth in vivo. |
Synonyms | BM040; TRAITS; U19 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |