EAF2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EAF2 antibody is: synthetic peptide directed towards the C-terminal region of Human EAF2. Synthetic peptide located within the following region: SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	ELL associated factor 2
Database Link	NP_060926 Entrez Gene 55840 Human UniProt ID Q96CJ1
Background	EAF2 acts as a transcriptional transactivator of TCEA1 elongation activity and a transcriptional transactivator of ELL and ELL2 elongation activities. EAF2 is a potent inducer of apoptosis in prostatic and non-prostatic cell lines and inhibits prostate tumor growth in vivo.
Synonyms	BM040; TRAITS; U19
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.