Glp1r Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Glp1r antibody is: synthetic peptide directed towards the middle region of Mouse Glp1r. Synthetic peptide located within the following region: YRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	glucagon-like peptide 1 receptor
Database Link	NP_067307 Entrez Gene 14652 Mouse UniProt ID O35659
Background	The function of this protein remains unknown.
Synonyms	GLP-1-R; GLP-1R; MGC138331
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Guinea pig: 93%; Mouse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.