THADA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-THADA antibody is: synthetic peptide directed towards the C-terminal region of Human THADA. Synthetic peptide located within the following region: SQVLYKLEQSKSKREPENELTKQHPSVSLQQYKNFMSSICNSLFEALFPG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	95 kDa
Gene Name	THADA, armadillo repeat containing
Database Link	NP_071348 Entrez Gene 63892 Human UniProt ID Q6YHU6
Background	The function of this protein remains unknown.
Synonyms	ARMC13; GITA
Note	Immunogen Sequence Homology: Human: 100%; Pig: 85%; Guinea pig: 85%; Dog: 79%; Horse: 79%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.