Aig1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Aig1 antibody is: synthetic peptide directed towards the middle region of Mouse Aig1. Synthetic peptide located within the following region: AVFFGICVLTDLSSLLTRGSGNQEQERQLRKLISLRDWTLAVLAFPVGVF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	androgen-induced 1
Database Link	NP_079722 Entrez Gene 66253 Mouse UniProt ID Q9D8B1
Background	Aig1 may play a role in androgen-regulated growth of hair follicles.
Synonyms	AIG-1; dJ95L4.1; DKFZp686F03136; FLJ10485
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.