Matriptase 2 (TMPRSS6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	transmembrane protease, serine 6
Database Link	NP_705837 Entrez Gene 164656 Human UniProt ID Q8IU80
Background	TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.The protein encoded by this gene is a type II transmembrane serine proteinase that is found attached to the cell surface. The encoded protein may be involved in matrix remodeling processes in the liver.
Synonyms	IRIDA
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Protease, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.