SCUBE1 Rabbit Polyclonal Antibody
CAT#: TA337797
Rabbit Polyclonal Anti-SCUBE1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SCUBE1 antibody is: synthetic peptide directed towards the N-terminal region of Human SCUBE1. Synthetic peptide located within the following region: PGYKGEGKQCEDIDECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | signal peptide, CUB domain and EGF like domain containing 1 |
Database Link | |
Background | This gene encodes a cell surface glycoprotein that is a member of the SCUBE (signal peptide, CUB domain, EGF (epidermal growth factor)-like protein) family. Family members have an amino-terminal signal peptide, nine copies of EGF-like repeats and a CUB domain at the carboxyl terminus. This protein is expressed in platelets and endothelial cells and may play an important role in vascular biology. |
Synonyms | SCUBE1 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |