PIP5KL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIP5KL1 antibody: synthetic peptide directed towards the middle region of human PIP5KL1. Synthetic peptide located within the following region: VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	phosphatidylinositol-4-phosphate 5-kinase like 1
Database Link	NP_775763 Entrez Gene 138429 Human UniProt ID Q5T9C9
Background	PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.
Synonyms	bA203J24.5; PIPKH
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 85%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.