C18orf54 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C18orf54 antibody: synthetic peptide directed towards the middle region of human C18orf54. Synthetic peptide located within the following region: PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	chromosome 18 open reading frame 54
Database Link	NP_775800 Entrez Gene 162681 Human UniProt ID Q8IYD9
Background	The exact function of C18orf54 remains unknown.
Synonyms	LAS2
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Dog: 92%; Pig: 92%; Guinea pig: 85%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.