OTOP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OTOP1 antibody is: synthetic peptide directed towards the C-terminal region of Human OTOP1. Synthetic peptide located within the following region: KTKSESALIMFYLYAITLLMLMGAAGLAGIRIYRIDEKSLDESKNPARKL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	otopetrin 1
Database Link	NP_819056 Entrez Gene 133060 Human UniProt ID Q7RTM1
Background	OTOP1 is required for normal formation of otoconia in the inner ear. OTOP1 inhibits P2Y purinoceptors and modulates calcium homeostasis and influx of calcium in response to extracellular ATP.
Synonyms	MGC163302; MGC163304
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.