SPATA24 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPATA24 antibody: synthetic peptide directed towards the c terminal of human SPATA24. Synthetic peptide located within the following region: LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	spermatogenesis associated 24
Database Link	NP_919272 Entrez Gene 202051 Human UniProt ID Q86W54
Background	SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.SPATA24 may play a role in cytoplasm movement and removal during spermiogenesis.
Synonyms	CCDC161; T6441
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rat: 86%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.