Cst6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Cst6 antibody: synthetic peptide directed towards the middle region of human Cst6. Synthetic peptide located within the following region: CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	cystatin E/M
Database Link	NP_082899 Entrez Gene 73720 Mouse
Background	The function of Cst6 remains unknown.
Synonyms	Cystatin-6; Cystatin-E
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.