CHCHD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHCHD1 antibody: synthetic peptide directed towards the N terminal of human CHCHD1. Synthetic peptide located within the following region: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	13
Gene Name	coiled-coil-helix-coiled-coil-helix domain containing 1
Database Link	NP_976043 Entrez Gene 118487 Human UniProt ID Q96BP2
Background	The function of this protein remains unknown.
Synonyms	C10orf34; C2360; MRP-S37
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Goat: 86%; Bovine: 86%; Horse: 83%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.